PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678390802
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 566aa    MW: 62203.9 Da    PI: 7.3532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678390802genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094144462254
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                ++yp+ +++  LA+++gLt +qV++WF N R +
  678390802 414 HPYPTDTDKHMLASQTGLTRSQVSNWFINARVR 446
                89*****************************88 PP

2BELL76.44.4e-252883441672
       BELL  16 leeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                l +V krY qy++q+q v+ssFe+vagl sa+pY+slA k +S+hFr Lk+ai++++
  678390802 288 LYQVSKRYTQYHQQIQLVVSSFETVAGLSSATPYVSLAVKSVSKHFRFLKNAISDHL 344
                679**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.8E-21185342IPR006563POX domain
PfamPF075266.5E-28190341IPR006563POX domain
PROSITE profilePS5007112.179387450IPR001356Homeobox domain
SMARTSM003892.5E-9390454IPR001356Homeobox domain
CDDcd000863.22E-12390451No hitNo description
SuperFamilySSF466891.63E-17391456IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28393454IPR009057Homeodomain-like
PfamPF059203.6E-18407446IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MEMRSEFRGA QQARRDKLRA LDSGDSNDNP YAIYADCVGN NEMGYELCPC PEMLNVPANT  60
RSLPGPQWKS IGSEFVANHN PAAAPAPMFV GESVSSSSVK LANTTTAPPQ FIQQDQGQCF  120
GPVHEPVSFP EKPMDPDLYT QGALSLSLSS VPPPTLTVGD VANLARMRKD VVVGHRNPGP  180
LGPFTGYAII LRNSKFLRPA HQLLEELCFA ARPKILVDEI RVSGEDSGVS SQVFDEQGRD  240
PTGTNYSPEN LQTRARLLFL QEEVSNHQPS YNMSTTSFWR FSLGYIVLYQ VSKRYTQYHQ  300
QIQLVVSSFE TVAGLSSATP YVSLAVKSVS KHFRFLKNAI SDHLKNLRTA LGHDSCPPSN  360
VEAGPTFAFS DRGFLMSSKG PNDGAARHSW RPQRGLPERA VAILRAWLFD HFLHPYPTDT  420
DKHMLASQTG LTRSQVSNWF INARVRIWKP MVEEIHMLET KALAGEEGPS PSAAAAASGG  480
SQSLVQGHHQ HEMSESDGWN QDKRSRVEYH PQPAPGIRGS IVGFGGGSVS LTLGLRQSAE  540
NAQPGLPESH HLRQQFGSQF IRDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16396454563Homeobox protein Meis2
3k2a_B2e-16396454563Homeobox protein Meis2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089262.11e-122PREDICTED: uncharacterized protein LOC105170277
STRINGPGSC0003DMT4000208251e-109(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-80BEL1-like homeodomain 8